SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350272737|ref|YP_004884045.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350272737|ref|YP_004884045.1|
Domain Number 1 Region: 65-123,175-310
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000000000000126
Family AstE/AspA-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|350272737|ref|YP_004884045.1|
Sequence length 375
Comment putative hydrolase [Oscillibacter valericigenes Sjm18-20]
Sequence
MVQSKKKIYSAIAILIVTAIIATLAGMNFHAKRDFKEDIVAGKGVTSTFQLSQYNPNLAG
TVGDVTVYVLKGEKEGGSMLVLGGTHPNEPAGHMAAILLEENAKVDAGTIYVITNANNSG
FTHNDALEGVPQYIHFTTSSGDTRTFSYGSRATNPIDQWPDPDIYTHSSGQTLSGSETRN
LNRCYPGIADGTISERVTYAITTMIQTLDIDMEIDLHESSPEYAVNNATVAHERAMSIAS
EGVLNLQLDGIQMSLEPSPANLHGLSHRELGDFTDTYALLMETGNPSQGRLRGRTNENLV
LTGEDPCYAVAYKLGLLYVDYSAGDLPIQLRVGRHLMGITEYINAFNDNSDKKISVSGIP
TYDQMVSSNVGDWLL
Download sequence
Identical sequences G4L0X0
gi|350272737|ref|YP_004884045.1| WP_014120120.1.66763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]