SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350273024|ref|YP_004884332.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350273024|ref|YP_004884332.1|
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.00000000000994
Family Cell division protein ZapA-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|350273024|ref|YP_004884332.1|
Sequence length 118
Comment hypothetical protein OBV_46280 [Oscillibacter valericigenes Sjm18-20]
Sequence
MKNRVTMTICGEDYNFVADESPEYMEKVGAYVSKKMDEVLNGTKVGRSDAAVLAAANIAD
ELFKSYEAAEKLRSQIKGYVDEASHAQAEASDLKREVFRLQQKLDTKNGGNNGNGNRH
Download sequence
Identical sequences G4L262
WP_014120396.1.66763 gi|350273024|ref|YP_004884332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]