SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|350272118|ref|YP_004883426.1| from Oscillibacter valericigenes Sjm18-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|350272118|ref|YP_004883426.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily YjgF-like 7.07e-33
Family YjgF/L-PSP 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|350272118|ref|YP_004883426.1|
Sequence length 116
Comment YjgF/YER057c/UK114 family protein [Oscillibacter valericigenes Sjm18-20]
Sequence
MNIQRYEGNGRMSKAVVAGQTIYFCGQTCRDGGDIRVQTSAVLKKIDDLLAACGSDKRHL
LMVQIFLKDMADFAGLNEVYDKWIEDGYEPARACVQATMAAPDILVEIVVTAAVAS
Download sequence
Identical sequences G4KXB2
WP_014119518.1.66763 gi|350272118|ref|YP_004883426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]