SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556588189|ref|YP_008755743.1| from Streptococcus suis T15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556588189|ref|YP_008755743.1|
Domain Number 1 Region: 67-334
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.55e-71
Family L-arabinose binding protein-like 0.000000274
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.31e-19
Family GalR/LacI-like bacterial regulator 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556588189|ref|YP_008755743.1|
Sequence length 334
Comment catabolite control protein A [Streptococcus suis T15]
Sequence
MLNTDDTVTIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGL
ASKKTTTVGVVIPNIANAYFATLAKGIDDIADMYKYNIVLANSDENDEKEINVVNTLFSK
QVDGIIFMGYHLTDKIRAEFSRSRTPIVLAGTVDLEHQLPSVNIDYAAASVDAVNLLAKN
NKKIAFVSGPLVDDINGKVRFAGYKQGLKDNGIEFNEGLVFESKYKYEEGYSLAERILNA
GATAAYVAEDEIAAGLLNGVSDMGVKVPEDFEIITSDDSLVTKFTRPNLTSINQPLYDIG
AIAMRMLTKIMHKEELENREVVLNHGIKVRKSTK
Download sequence
Identical sequences A0A0Z8ISZ7 U5UDF9
gi|386580266|ref|YP_006076671.1| gi|476420218|ref|YP_007571214.1| WP_014636430.1.101447 WP_014636430.1.11330 WP_014636430.1.11918 WP_014636430.1.13051 WP_014636430.1.1616 WP_014636430.1.17388 WP_014636430.1.19378 WP_014636430.1.19521 WP_014636430.1.20400 WP_014636430.1.21348 WP_014636430.1.21994 WP_014636430.1.25841 WP_014636430.1.29542 WP_014636430.1.29610 WP_014636430.1.31425 WP_014636430.1.32380 WP_014636430.1.37914 WP_014636430.1.44134 WP_014636430.1.47108 WP_014636430.1.47119 WP_014636430.1.51052 WP_014636430.1.52490 WP_014636430.1.58933 WP_014636430.1.5894 WP_014636430.1.59702 WP_014636430.1.61415 WP_014636430.1.61715 WP_014636430.1.62710 WP_014636430.1.6272 WP_014636430.1.63174 WP_014636430.1.69056 WP_014636430.1.70484 WP_014636430.1.7342 WP_014636430.1.76666 WP_014636430.1.86836 WP_014636430.1.88882 WP_014636430.1.88972 WP_014636430.1.89038 WP_014636430.1.91387 WP_014636430.1.98406 gi|556588189|ref|YP_008755743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]