SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556588296|ref|YP_008755850.1| from Streptococcus suis T15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556588296|ref|YP_008755850.1|
Domain Number 1 Region: 44-301
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.24e-17
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|556588296|ref|YP_008755850.1|
Sequence length 324
Comment hypothetical protein T15_0707 [Streptococcus suis T15]
Sequence
MYYKLVKKLATISVASMGLLTLAACSSSSEQASSDVVKVGVLQYMEHESLTAAREGFVAE
LEANGYKEGEKLVLDYQNAQGDQANLQTISEQLIDGNDIVLAIATPSAQSLATVSTETPI
VFTAVTDPLSADLVESIEKPGGLLTGTSDQAPIDKQVELLGQAVPDAKTVGILYTTSERN
SEVQVEQAKELLEKAGYKVVVKGITSSNEVQDATTSLMKDVDALFIPTDNTVASTMTMIG
ELSVEHKVPVIGGSTDMVDEGGLLTYGTNYEALGRQTAKMAIKIIEGANVSETAVEYPET
VSLHVNEEMAQKLGIDTSKLAVSE
Download sequence
Identical sequences A0A075SEC6 A0A0H3MUE6 A0A0Z8C8G7 U5UGZ2
gi|253753809|ref|YP_003026950.1| gi|556588296|ref|YP_008755850.1| gi|253755315|ref|YP_003028455.1| 218494.SSU1092 391296.SSU98_1270 568813.SSUSC84_1125 568814.SSUBM407_0697 gi|386580158|ref|YP_006076563.1| gi|476420113|ref|YP_007571109.1| WP_012028291.1.10007 WP_012028291.1.100280 WP_012028291.1.100404 WP_012028291.1.100670 WP_012028291.1.100701 WP_012028291.1.100908 WP_012028291.1.101097 WP_012028291.1.101179 WP_012028291.1.101295 WP_012028291.1.101447 WP_012028291.1.101621 WP_012028291.1.101658 WP_012028291.1.101706 WP_012028291.1.101901 WP_012028291.1.102003 WP_012028291.1.102038 WP_012028291.1.10265 WP_012028291.1.1035 WP_012028291.1.10700 WP_012028291.1.10896 WP_012028291.1.10904 WP_012028291.1.11017 WP_012028291.1.11116 WP_012028291.1.11330 WP_012028291.1.11527 WP_012028291.1.11548 WP_012028291.1.11662 WP_012028291.1.11869 WP_012028291.1.11874 WP_012028291.1.11918 WP_012028291.1.1200 WP_012028291.1.12022 WP_012028291.1.12228 WP_012028291.1.12368 WP_012028291.1.1244 WP_012028291.1.12606 WP_012028291.1.12665 WP_012028291.1.12803 WP_012028291.1.12908 WP_012028291.1.13051 WP_012028291.1.13095 WP_012028291.1.13153 WP_012028291.1.1324 WP_012028291.1.13380 WP_012028291.1.13633 WP_012028291.1.13861 WP_012028291.1.1405 WP_012028291.1.14202 WP_012028291.1.14210 WP_012028291.1.1424 WP_012028291.1.1434 WP_012028291.1.14359 WP_012028291.1.1495 WP_012028291.1.15112 WP_012028291.1.1537 WP_012028291.1.15393 WP_012028291.1.15414 WP_012028291.1.15545 WP_012028291.1.15756 WP_012028291.1.15813 WP_012028291.1.1616 WP_012028291.1.16193 WP_012028291.1.16255 WP_012028291.1.16271 WP_012028291.1.1629 WP_012028291.1.16498 WP_012028291.1.16643 WP_012028291.1.16677 WP_012028291.1.16683 WP_012028291.1.16773 WP_012028291.1.16829 WP_012028291.1.16881 WP_012028291.1.17264 WP_012028291.1.17388 WP_012028291.1.17670 WP_012028291.1.17749 WP_012028291.1.17814 WP_012028291.1.17958 WP_012028291.1.17989 WP_012028291.1.18076 WP_012028291.1.18271 WP_012028291.1.18341 WP_012028291.1.18403 WP_012028291.1.18563 WP_012028291.1.18711 WP_012028291.1.18850 WP_012028291.1.19145 WP_012028291.1.19352 WP_012028291.1.19378 WP_012028291.1.19521 WP_012028291.1.1953 WP_012028291.1.19865 WP_012028291.1.19898 WP_012028291.1.1991 WP_012028291.1.20400 WP_012028291.1.20518 WP_012028291.1.20584 WP_012028291.1.20756 WP_012028291.1.20792 WP_012028291.1.20944 WP_012028291.1.21347 WP_012028291.1.21348 WP_012028291.1.21374 WP_012028291.1.21457 WP_012028291.1.21903 WP_012028291.1.21994 WP_012028291.1.22347 WP_012028291.1.22785 WP_012028291.1.22805 WP_012028291.1.22848 WP_012028291.1.22882 WP_012028291.1.23089 WP_012028291.1.23273 WP_012028291.1.23317 WP_012028291.1.23358 WP_012028291.1.23682 WP_012028291.1.23965 WP_012028291.1.24078 WP_012028291.1.24150 WP_012028291.1.24175 WP_012028291.1.24187 WP_012028291.1.24431 WP_012028291.1.24858 WP_012028291.1.24883 WP_012028291.1.25245 WP_012028291.1.25280 WP_012028291.1.25381 WP_012028291.1.25396 WP_012028291.1.25617 WP_012028291.1.25711 WP_012028291.1.25824 WP_012028291.1.25841 WP_012028291.1.25950 WP_012028291.1.26009 WP_012028291.1.26302 WP_012028291.1.26324 WP_012028291.1.26368 WP_012028291.1.26507 WP_012028291.1.26620 WP_012028291.1.27108 WP_012028291.1.27225 WP_012028291.1.27227 WP_012028291.1.27381 WP_012028291.1.27476 WP_012028291.1.27695 WP_012028291.1.27754 WP_012028291.1.27760 WP_012028291.1.27767 WP_012028291.1.28000 WP_012028291.1.28033 WP_012028291.1.28244 WP_012028291.1.28467 WP_012028291.1.28645 WP_012028291.1.28796 WP_012028291.1.28805 WP_012028291.1.28908 WP_012028291.1.29141 WP_012028291.1.29299 WP_012028291.1.29542 WP_012028291.1.29545 WP_012028291.1.29610 WP_012028291.1.29935 WP_012028291.1.30079 WP_012028291.1.30241 WP_012028291.1.30344 WP_012028291.1.30414 WP_012028291.1.30520 WP_012028291.1.30785 WP_012028291.1.31254 WP_012028291.1.31425 WP_012028291.1.31597 WP_012028291.1.31730 WP_012028291.1.32259 WP_012028291.1.32292 WP_012028291.1.32332 WP_012028291.1.32380 WP_012028291.1.32466 WP_012028291.1.32630 WP_012028291.1.32947 WP_012028291.1.33330 WP_012028291.1.33471 WP_012028291.1.34321 WP_012028291.1.34425 WP_012028291.1.34527 WP_012028291.1.34652 WP_012028291.1.34738 WP_012028291.1.35430 WP_012028291.1.35551 WP_012028291.1.35675 WP_012028291.1.35725 WP_012028291.1.36136 WP_012028291.1.36153 WP_012028291.1.36180 WP_012028291.1.36251 WP_012028291.1.36341 WP_012028291.1.36437 WP_012028291.1.36611 WP_012028291.1.36766 WP_012028291.1.36945 WP_012028291.1.37126 WP_012028291.1.37237 WP_012028291.1.376 WP_012028291.1.37653 WP_012028291.1.37688 WP_012028291.1.37816 WP_012028291.1.37841 WP_012028291.1.37914 WP_012028291.1.37915 WP_012028291.1.38285 WP_012028291.1.38409 WP_012028291.1.38470 WP_012028291.1.39011 WP_012028291.1.39023 WP_012028291.1.39247 WP_012028291.1.39263 WP_012028291.1.39280 WP_012028291.1.39714 WP_012028291.1.3989 WP_012028291.1.40062 WP_012028291.1.40141 WP_012028291.1.40228 WP_012028291.1.40265 WP_012028291.1.40384 WP_012028291.1.40507 WP_012028291.1.40669 WP_012028291.1.4074 WP_012028291.1.40802 WP_012028291.1.41046 WP_012028291.1.41052 WP_012028291.1.41112 WP_012028291.1.41280 WP_012028291.1.41340 WP_012028291.1.41522 WP_012028291.1.41854 WP_012028291.1.42323 WP_012028291.1.42552 WP_012028291.1.42596 WP_012028291.1.4278 WP_012028291.1.42784 WP_012028291.1.42827 WP_012028291.1.42840 WP_012028291.1.4291 WP_012028291.1.43193 WP_012028291.1.43264 WP_012028291.1.43288 WP_012028291.1.43482 WP_012028291.1.43813 WP_012028291.1.43922 WP_012028291.1.43963 WP_012028291.1.43977 WP_012028291.1.44047 WP_012028291.1.44128 WP_012028291.1.44134 WP_012028291.1.44592 WP_012028291.1.44676 WP_012028291.1.44778 WP_012028291.1.45088 WP_012028291.1.45216 WP_012028291.1.45219 WP_012028291.1.45278 WP_012028291.1.45345 WP_012028291.1.45864 WP_012028291.1.45936 WP_012028291.1.467 WP_012028291.1.46880 WP_012028291.1.47108 WP_012028291.1.47119 WP_012028291.1.47315 WP_012028291.1.47375 WP_012028291.1.47434 WP_012028291.1.4748 WP_012028291.1.4757 WP_012028291.1.47643 WP_012028291.1.47745 WP_012028291.1.47894 WP_012028291.1.47900 WP_012028291.1.48167 WP_012028291.1.48217 WP_012028291.1.48397 WP_012028291.1.4858 WP_012028291.1.48583 WP_012028291.1.48603 WP_012028291.1.49093 WP_012028291.1.49099 WP_012028291.1.49206 WP_012028291.1.49255 WP_012028291.1.49368 WP_012028291.1.49413 WP_012028291.1.49509 WP_012028291.1.49782 WP_012028291.1.49968 WP_012028291.1.50047 WP_012028291.1.5021 WP_012028291.1.50437 WP_012028291.1.50538 WP_012028291.1.50551 WP_012028291.1.50675 WP_012028291.1.50751 WP_012028291.1.5079 WP_012028291.1.50798 WP_012028291.1.51052 WP_012028291.1.51155 WP_012028291.1.51263 WP_012028291.1.51386 WP_012028291.1.51551 WP_012028291.1.52159 WP_012028291.1.52175 WP_012028291.1.52490 WP_012028291.1.52599 WP_012028291.1.52628 WP_012028291.1.52798 WP_012028291.1.53174 WP_012028291.1.53290 WP_012028291.1.53309 WP_012028291.1.534 WP_012028291.1.53448 WP_012028291.1.53487 WP_012028291.1.53749 WP_012028291.1.53805 WP_012028291.1.54000 WP_012028291.1.5404 WP_012028291.1.54184 WP_012028291.1.54384 WP_012028291.1.54488 WP_012028291.1.54535 WP_012028291.1.54800 WP_012028291.1.54828 WP_012028291.1.55064 WP_012028291.1.55137 WP_012028291.1.55158 WP_012028291.1.55649 WP_012028291.1.55687 WP_012028291.1.55714 WP_012028291.1.5579 WP_012028291.1.55815 WP_012028291.1.55833 WP_012028291.1.55834 WP_012028291.1.55864 WP_012028291.1.56077 WP_012028291.1.56140 WP_012028291.1.56150 WP_012028291.1.56215 WP_012028291.1.56434 WP_012028291.1.56463 WP_012028291.1.57067 WP_012028291.1.5714 WP_012028291.1.57164 WP_012028291.1.5754 WP_012028291.1.57640 WP_012028291.1.57674 WP_012028291.1.57810 WP_012028291.1.58229 WP_012028291.1.58517 WP_012028291.1.58566 WP_012028291.1.58585 WP_012028291.1.58706 WP_012028291.1.58725 WP_012028291.1.58746 WP_012028291.1.58793 WP_012028291.1.58815 WP_012028291.1.58903 WP_012028291.1.58933 WP_012028291.1.5894 WP_012028291.1.59071 WP_012028291.1.59138 WP_012028291.1.59144 WP_012028291.1.59283 WP_012028291.1.59349 WP_012028291.1.5936 WP_012028291.1.59524 WP_012028291.1.59647 WP_012028291.1.5974 WP_012028291.1.59929 WP_012028291.1.60237 WP_012028291.1.60293 WP_012028291.1.60377 WP_012028291.1.60445 WP_012028291.1.60658 WP_012028291.1.60659 WP_012028291.1.6071 WP_012028291.1.60853 WP_012028291.1.609 WP_012028291.1.61370 WP_012028291.1.61415 WP_012028291.1.61533 WP_012028291.1.61540 WP_012028291.1.6156 WP_012028291.1.6165 WP_012028291.1.61715 WP_012028291.1.61885 WP_012028291.1.6223 WP_012028291.1.62268 WP_012028291.1.62485 WP_012028291.1.62497 WP_012028291.1.62710 WP_012028291.1.6272 WP_012028291.1.6278 WP_012028291.1.62805 WP_012028291.1.63018 WP_012028291.1.63174 WP_012028291.1.63318 WP_012028291.1.63653 WP_012028291.1.63685 WP_012028291.1.63959 WP_012028291.1.64120 WP_012028291.1.64128 WP_012028291.1.64273 WP_012028291.1.64281 WP_012028291.1.64384 WP_012028291.1.64641 WP_012028291.1.64797 WP_012028291.1.64952 WP_012028291.1.64997 WP_012028291.1.65024 WP_012028291.1.65047 WP_012028291.1.65161 WP_012028291.1.65174 WP_012028291.1.65184 WP_012028291.1.65314 WP_012028291.1.65422 WP_012028291.1.65458 WP_012028291.1.65905 WP_012028291.1.65911 WP_012028291.1.65917 WP_012028291.1.6596 WP_012028291.1.66185 WP_012028291.1.66186 WP_012028291.1.66360 WP_012028291.1.66472 WP_012028291.1.66521 WP_012028291.1.66590 WP_012028291.1.66609 WP_012028291.1.66707 WP_012028291.1.6686 WP_012028291.1.67058 WP_012028291.1.67109 WP_012028291.1.6711 WP_012028291.1.67256 WP_012028291.1.67338 WP_012028291.1.67488 WP_012028291.1.677 WP_012028291.1.67883 WP_012028291.1.67897 WP_012028291.1.67958 WP_012028291.1.67962 WP_012028291.1.68010 WP_012028291.1.68303 WP_012028291.1.68602 WP_012028291.1.68666 WP_012028291.1.68739 WP_012028291.1.68791 WP_012028291.1.68941 WP_012028291.1.69056 WP_012028291.1.69115 WP_012028291.1.69161 WP_012028291.1.69413 WP_012028291.1.69454 WP_012028291.1.6967 WP_012028291.1.69698 WP_012028291.1.69922 WP_012028291.1.70033 WP_012028291.1.70102 WP_012028291.1.70387 WP_012028291.1.70484 WP_012028291.1.70817 WP_012028291.1.70997 WP_012028291.1.71125 WP_012028291.1.71140 WP_012028291.1.71425 WP_012028291.1.71432 WP_012028291.1.71462 WP_012028291.1.71498 WP_012028291.1.71727 WP_012028291.1.71914 WP_012028291.1.72174 WP_012028291.1.72247 WP_012028291.1.72296 WP_012028291.1.72413 WP_012028291.1.7257 WP_012028291.1.72611 WP_012028291.1.73011 WP_012028291.1.73262 WP_012028291.1.73280 WP_012028291.1.73299 WP_012028291.1.7342 WP_012028291.1.73679 WP_012028291.1.73721 WP_012028291.1.73905 WP_012028291.1.74090 WP_012028291.1.74132 WP_012028291.1.74567 WP_012028291.1.74800 WP_012028291.1.74843 WP_012028291.1.74865 WP_012028291.1.75022 WP_012028291.1.75028 WP_012028291.1.75605 WP_012028291.1.75930 WP_012028291.1.75965 WP_012028291.1.75985 WP_012028291.1.76083 WP_012028291.1.76175 WP_012028291.1.76400 WP_012028291.1.76666 WP_012028291.1.76735 WP_012028291.1.76808 WP_012028291.1.76907 WP_012028291.1.77006 WP_012028291.1.77026 WP_012028291.1.77548 WP_012028291.1.77616 WP_012028291.1.77624 WP_012028291.1.77781 WP_012028291.1.77795 WP_012028291.1.77958 WP_012028291.1.78138 WP_012028291.1.78326 WP_012028291.1.78456 WP_012028291.1.7873 WP_012028291.1.78744 WP_012028291.1.78792 WP_012028291.1.7889 WP_012028291.1.78945 WP_012028291.1.79054 WP_012028291.1.79154 WP_012028291.1.79162 WP_012028291.1.79499 WP_012028291.1.79644 WP_012028291.1.79679 WP_012028291.1.80097 WP_012028291.1.80131 WP_012028291.1.80153 WP_012028291.1.80169 WP_012028291.1.80216 WP_012028291.1.80418 WP_012028291.1.8061 WP_012028291.1.80716 WP_012028291.1.80742 WP_012028291.1.80787 WP_012028291.1.81103 WP_012028291.1.81370 WP_012028291.1.81513 WP_012028291.1.81584 WP_012028291.1.81705 WP_012028291.1.82122 WP_012028291.1.8251 WP_012028291.1.82830 WP_012028291.1.82870 WP_012028291.1.82977 WP_012028291.1.83279 WP_012028291.1.83818 WP_012028291.1.83879 WP_012028291.1.83915 WP_012028291.1.84389 WP_012028291.1.84412 WP_012028291.1.8451 WP_012028291.1.85051 WP_012028291.1.85075 WP_012028291.1.85327 WP_012028291.1.85437 WP_012028291.1.85450 WP_012028291.1.85908 WP_012028291.1.86151 WP_012028291.1.86177 WP_012028291.1.86817 WP_012028291.1.86836 WP_012028291.1.86842 WP_012028291.1.87044 WP_012028291.1.87321 WP_012028291.1.87344 WP_012028291.1.87438 WP_012028291.1.87450 WP_012028291.1.87819 WP_012028291.1.87874 WP_012028291.1.87885 WP_012028291.1.8790 WP_012028291.1.88201 WP_012028291.1.88543 WP_012028291.1.88575 WP_012028291.1.88635 WP_012028291.1.88653 WP_012028291.1.88746 WP_012028291.1.88779 WP_012028291.1.88882 WP_012028291.1.88972 WP_012028291.1.89037 WP_012028291.1.89038 WP_012028291.1.89056 WP_012028291.1.89128 WP_012028291.1.89156 WP_012028291.1.89279 WP_012028291.1.89358 WP_012028291.1.89388 WP_012028291.1.89800 WP_012028291.1.8993 WP_012028291.1.89981 WP_012028291.1.89989 WP_012028291.1.90172 WP_012028291.1.90419 WP_012028291.1.90742 WP_012028291.1.90917 WP_012028291.1.90961 WP_012028291.1.91238 WP_012028291.1.91387 WP_012028291.1.91636 WP_012028291.1.91865 WP_012028291.1.91912 WP_012028291.1.91973 WP_012028291.1.91983 WP_012028291.1.92134 WP_012028291.1.92263 WP_012028291.1.92441 WP_012028291.1.92554 WP_012028291.1.92692 WP_012028291.1.92722 WP_012028291.1.928 WP_012028291.1.93190 WP_012028291.1.93456 WP_012028291.1.93510 WP_012028291.1.93519 WP_012028291.1.9361 WP_012028291.1.93627 WP_012028291.1.93646 WP_012028291.1.9376 WP_012028291.1.93771 WP_012028291.1.94332 WP_012028291.1.94338 WP_012028291.1.94418 WP_012028291.1.94419 WP_012028291.1.94449 WP_012028291.1.9454 WP_012028291.1.94639 WP_012028291.1.94786 WP_012028291.1.94945 WP_012028291.1.95180 WP_012028291.1.95213 WP_012028291.1.95214 WP_012028291.1.95262 WP_012028291.1.95288 WP_012028291.1.95351 WP_012028291.1.95542 WP_012028291.1.95798 WP_012028291.1.96021 WP_012028291.1.96164 WP_012028291.1.96282 WP_012028291.1.96427 WP_012028291.1.96451 WP_012028291.1.9652 WP_012028291.1.96524 WP_012028291.1.96574 WP_012028291.1.96700 WP_012028291.1.97052 WP_012028291.1.97453 WP_012028291.1.97493 WP_012028291.1.97504 WP_012028291.1.97554 WP_012028291.1.97722 WP_012028291.1.97857 WP_012028291.1.9809 WP_012028291.1.9815 WP_012028291.1.98253 WP_012028291.1.98271 WP_012028291.1.98326 WP_012028291.1.98343 WP_012028291.1.98406 WP_012028291.1.98416 WP_012028291.1.98860 WP_012028291.1.98864 WP_012028291.1.98889 WP_012028291.1.98921 WP_012028291.1.98999 WP_012028291.1.99127 WP_012028291.1.9922 WP_012028291.1.99252 WP_012028291.1.99696 WP_012028291.1.99988 YP_003028455.1.79686 gi|253751984|ref|YP_003025125.1| gi|403061740|ref|YP_006649956.1| gi|386582181|ref|YP_006078585.1| gi|146321117|ref|YP_001200828.1| gi|386588368|ref|YP_006084769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]