SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556589076|ref|YP_008756630.1| from Streptococcus suis T15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556589076|ref|YP_008756630.1|
Domain Number 1 Region: 37-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.55e-17
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|556589076|ref|YP_008756630.1|
Sequence length 333
Comment hypothetical protein T15_1501 [Streptococcus suis T15]
Sequence
MLKNKNLLATIVALTVMVVAALFMTQKEQSNSSTSTEKVKIGVLQFVTHDSLDEIYKGIK
AGLKEGGYTTTDNLEIDFMNAEGDQSQVQTMSKKLVDNGNELLIGIATPAAQGLANATTE
LPIIMGAVTDPVGANLVTDLKNPGGNITGVSDQTPVADTVSLIKEITPDAKTIGVLYSSN
EDNSKIQVAEFKAAAEEAGYTVLEYAVASSNEIAATVEVASSKADVLFTPVDNTVASAFS
TVVSVANKTKTPIFTSVEDMVEGGGIASVTLSQYDLGVATGKMAAKILDGANPADTPVQI
FNEGTVVVNQKVAKELGITLSDDVISKASKVIE
Download sequence
Identical sequences A0A0Z8NEH2 U5UJC3
gi|556589076|ref|YP_008756630.1| WP_023370871.1.101447 WP_023370871.1.11918 WP_023370871.1.13051 WP_023370871.1.1616 WP_023370871.1.17388 WP_023370871.1.19521 WP_023370871.1.21348 WP_023370871.1.21994 WP_023370871.1.25841 WP_023370871.1.29542 WP_023370871.1.31425 WP_023370871.1.32380 WP_023370871.1.33623 WP_023370871.1.36180 WP_023370871.1.37914 WP_023370871.1.44134 WP_023370871.1.47108 WP_023370871.1.47119 WP_023370871.1.58933 WP_023370871.1.61415 WP_023370871.1.61715 WP_023370871.1.62710 WP_023370871.1.6272 WP_023370871.1.63174 WP_023370871.1.69056 WP_023370871.1.70484 WP_023370871.1.7342 WP_023370871.1.76666 WP_023370871.1.78138 WP_023370871.1.88746 WP_023370871.1.88882 WP_023370871.1.88972 WP_023370871.1.91387 WP_023370871.1.98406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]