SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0159367 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0159367
Domain Number 1 Region: 31-257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-49
Family Extended AAA-ATPase domain 0.000000656
Further Details:      
 
Domain Number 2 Region: 263-349
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 6.38e-19
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0159367   Gene: FBgn0132916   Transcript: FBtr0160875
Sequence length 354
Comment type=protein; loc=scaffold_6540:join(22140558..22140667,22140752..22141619,22141679..22141765); ID=FBpp0159367; name=DmojGI10150-PA; parent=FBgn0132916,FBtr0160875; dbxref=FlyBase:FBpp0159367,FlyBase_Annotation_IDs:GI10150-PA,GB_protein:EDW15757,REFSEQ:XP_002000296,FlyMine:FBpp0159367; MD5=0ab2ed6f448a077940bc6b4de911687d; length=354; release=r1.3; species=Dmoj;
Sequence
MQAFLKAGKSANGTTEKQASNAPTERRKPPAPWVEKYRPRSVEDVVEQSEVVAVLRKCVE
GADLPNMLLYGPPGTGKTSTILAAARQIFGDMYRDRILELNASDERGINVVRTKIKNFAQ
LTASNVRPDGRPCPPFKIIVLDEADSMTHAAQAALRRTMEKESRSTRFCLICNYVSRIIV
PITSRCSKFRFKALGETQIIARLKHICMQENVNIDPDAYKSIVKISGGDMRRAITTLQSC
YRLKGSDHTINTDDLLEMSGIIPEHYLEDYLEVCRSGKYERLEHFVREIGYSAYSVGQMM
EQFVEFIVRCGSLTDKQKAIICDKLGECCYRLQDGGSEYLQIMDLGCTIILALK
Download sequence
Identical sequences B4KB53
FBpp0159367 XP_002000296.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]