SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0159691 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0159691
Domain Number 1 Region: 17-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-46
Family G proteins 0.000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0159691   Gene: FBgn0133238   Transcript: FBtr0161199
Sequence length 193
Comment type=protein; loc=scaffold_6540:join(27900551..27900593,27900919..27901038,27901114..27901179,27902299..27902534,27902605..27902721); ID=FBpp0159691; name=DmojGI10474-PA; parent=FBgn0133238,FBtr0161199; dbxref=FlyBase:FBpp0159691,FlyBase_Annotation_IDs:GI10474-PA,GB_protein:EDW16342,REFSEQ:XP_002000881,FlyMine:FBpp0159691; MD5=449056d0fe00e402185123971296498f; length=193; release=r1.3; species=Dmoj;
Sequence
MFIWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVPTLHPTSEELS
IGNMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDRGRFQESKNELDSLLTDEALS
NCPVLILGNKIDKPGAASEDELRNVFGLYQLTTGKGKVARSELPGRPLELFMCSVLKRQG
YGEGFRWLAQYID
Download sequence
Identical sequences B4K729 B4M0D6
FBpp0237573 FBpp0159691 XP_002000881.1.58863 XP_002053778.1.90633 XP_015023160.1.58863 XP_015023161.1.58863 XP_015023162.1.58863 XP_015023163.1.58863 XP_015027091.1.90633 XP_017862743.1.65068 7244.FBpp0237573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]