SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0160054 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0160054
Domain Number 1 Region: 7-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.48e-66
Family G proteins 0.0000000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0160054   Gene: FBgn0133600   Transcript: FBtr0161562
Sequence length 205
Comment type=protein; loc=scaffold_6540:join(33864376..33864398,33865638..33865758,33865823..33865870,33865927..33866154,33866226..33866423); ID=FBpp0160054; name=DmojGI10837-PA; parent=FBgn0133600,FBtr0161562; dbxref=FlyBase:FBpp0160054,FlyBase_Annotation_IDs:GI10837-PA,GB_protein:EDW16972,REFSEQ:XP_002001511,FlyMine:FBpp0160054; MD5=46b8ae4c833d2ef56ee059da65444690; length=205; release=r1.3; species=Dmoj;
Sequence
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKL
LVGNKSDLTTKKVVDHTTAAEYAHQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPS
SATDNASKVKIDQGRPVENTRSGCC
Download sequence
Identical sequences B4KCV0
FBpp0160054 XP_002001511.1.58863 XP_017865962.1.65068 XP_017958504.1.46654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]