SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0160090 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0160090
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000407
Family Extended AAA-ATPase domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0160090   Gene: FBgn0133636   Transcript: FBtr0161598
Sequence length 140
Comment type=protein; loc=scaffold_6445:72863..73285; ID=FBpp0160090; name=DmojGI10873-PA; parent=FBgn0133636,FBtr0161598; dbxref=FlyBase:FBpp0160090,FlyBase_Annotation_IDs:GI10873-PA,GB_protein:EDW06640,REFSEQ:XP_002012388,FlyMine:FBpp0160090; MD5=a61c4d83870c360a58edff3011827877; length=140; release=r1.3; species=Dmoj;
Sequence
MNSIAYQLKVLSVVAVQVKCMQDAIKAKKTTFSFLGEYIALRATVGVFITMNPGYAGRAE
LPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYD
WGLRAIKSVLVVAGALRVSE
Download sequence
Identical sequences FBpp0160090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]