SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0160251 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0160251
Domain Number 1 Region: 5-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-61
Family G proteins 0.000000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0160251   Gene: FBgn0133797   Transcript: FBtr0161759
Sequence length 204
Comment type=protein; loc=scaffold_6308:complement(597085..597282,597367..597456,597536..597735,598448..598574); ID=FBpp0160251; name=DmojGI11034-PA; parent=FBgn0133797,FBtr0161759; dbxref=FlyBase:FBpp0160251,FlyBase_Annotation_IDs:GI11034-PA,GB_protein:EDW05543,REFSEQ:XP_002011553,FlyMine:FBpp0160251; MD5=fdcd0de4412935ff16f6560ff032da38; length=204; release=r1.3; species=Dmoj;
Sequence
MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMIL
GNKCDMSDKRVVSKERGEAIAREHSIRFMETSAKSNINIERAFCELAEAILDKTSGRESA
ENPERVVIDRGNSDKATSYSKCCA
Download sequence
Identical sequences B4L7W8
FBpp0160251 XP_002011553.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]