SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0160326 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0160326
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-56
Family G proteins 0.000000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0160326   Gene: FBgn0133870   Transcript: FBtr0161834
Sequence length 191
Comment type=protein; loc=scaffold_6308:join(751841..752128,752205..752492); ID=FBpp0160326; name=DmojGI11109-PA; parent=FBgn0133870,FBtr0161834; dbxref=FlyBase:FBpp0160326,FlyBase_Annotation_IDs:GI11109-PA,GB_protein:EDW05574,REFSEQ:XP_002011584,FlyMine:FBpp0160326; MD5=82081b6b1f41b7c0697c47900b9b1694; length=191; release=r1.3; species=Dmoj;
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR
DETSTLEKLAKNKQKPITSEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPTKRRKCRFL
Download sequence
Identical sequences B4L7Z9
XP_002011584.1.58863 XP_017871626.1.65068 XP_017963781.1.46654 FBpp0160326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]