SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0160457 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0160457
Domain Number 1 Region: 8-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-21
Family G proteins 0.0000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0160457   Gene: FBgn0134001   Transcript: FBtr0161965
Sequence length 203
Comment type=protein; loc=scaffold_6500:complement(14062217..14062828); ID=FBpp0160457; name=DmojGI11240-PA; parent=FBgn0134001,FBtr0161965; dbxref=FlyBase:FBpp0160457,FlyBase_Annotation_IDs:GI11240-PA,GB_protein:EDW12194,REFSEQ:XP_002002752,FlyMine:FBpp0160457; MD5=ee57578d906c7cfb3477542b5d6a7580; length=203; release=r1.3; species=Dmoj;
Sequence
MSTEVPMYCCALLGAPESGKTSFAKRHLTGEFVKSYSANKIYQTYLLEFHTSQGDIRYTL
WNSNQIDDFDCLHIQCAIIMTDFSCTRTFQRVPVLQTAIHIRYGNIPVALCANKMDLARS
NGIAYRLIPDQPKQFEYFEMSVKKNVNCEQPFLWLSRRLLGNDQLEFVAKPAVQPPDIPP
AHWKAAFKGLALNQLPPIGDDEW
Download sequence
Identical sequences B4KGJ8
FBpp0160457 XP_002002752.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]