SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0161490 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0161490
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.29e-58
Family G proteins 0.0000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0161490   Gene: FBgn0135030   Transcript: FBtr0162998
Sequence length 192
Comment type=protein; loc=scaffold_6680:complement(6791241..6791819); ID=FBpp0161490; name=DmojGI12273-PA; parent=FBgn0135030,FBtr0162998; dbxref=FlyBase:FBpp0161490,FlyBase_Annotation_IDs:GI12273-PA,GB_protein:EDW18111,REFSEQ:XP_002007635,FlyMine:FBpp0161490; MD5=9d7e6928ebd6abe5e863a648ff8a38f1; length=192; release=r1.3; species=Dmoj;
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV
LQPKSKRKCALL
Download sequence
Identical sequences A0A1W4W6P4 B3NB87 B4HVR1 B4L0N4 B4LG76 B4PD66 B4QLZ5 M9PBH7 P40792 Q29EV6
FBpp0195702 FBpp0161490 DS10_00004528 FBpp0211889 FBpp0265982 FBpp0133157 FBpp0072614 NP_001261247.1.81976 NP_476950.1.81976 XP_001352457.1.19638 XP_001971114.1.56816 XP_002007635.1.58863 XP_002034890.1.34323 XP_002047042.1.90633 XP_002093102.1.41174 XP_016029788.1.80810 XP_016933218.1.48971 XP_016959661.1.21709 XP_016984147.1.97277 XP_016993229.1.47939 XP_017059679.1.74164 XP_017063521.1.81094 XP_017127681.1.32376 XP_017138436.1.22881 XP_017863107.1.65068 XP_017957405.1.46654 XP_020812001.1.32911 FBpp0072614 FBpp0286665 FBpp0227626 7227.FBpp0072614 7237.FBpp0286665 7244.FBpp0227626 7245.FBpp0265982 FBpp0072614 FBpp0304252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]