SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0161630 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0161630
Domain Number 1 Region: 49-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-25
Family G proteins 0.0000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0161630   Gene: FBgn0135170   Transcript: FBtr0163138
Sequence length 244
Comment type=protein; loc=scaffold_6680:complement(4692834..4693029,4693088..4693213,4693270..4693576,4693652..4693757); ID=FBpp0161630; name=DmojGI12413-PA; parent=FBgn0135170,FBtr0163138; dbxref=FlyBase:FBpp0161630,FlyBase_Annotation_IDs:GI12413-PA,GB_protein:EDW17869,REFSEQ:XP_002007393,FlyMine:FBpp0161630; MD5=44e021ca33bb96a98a61764459770515; length=244; release=r1.3; species=Dmoj;
Sequence
MDKLNQNAREKKEIKLDNIDVTPILAALIVGFIAVALFVIFRRRSATRHDFLLTGLTEAG
KSAIFMQLVHNKFPDTFTSMKENVGEYRSGHVSGRLVDIPGHYRVRDKCFERYKHNAKGI
IFVVDSVTIQKDIRDVADTLYTILADSATQPCSVLILCNKQDLTTAKSSQVIKSLLEKEL
NTVRDTRSRKLQSVGDDELNKSITLGKVGRDFEFSHISQNVQFFESSAKEKQLNDLRDWI
DRML
Download sequence
Identical sequences B4KZ72
FBpp0161630 XP_002007393.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]