SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0161675 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0161675
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-57
Family G proteins 0.000000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0161675   Gene: FBgn0135215   Transcript: FBtr0163183
Sequence length 192
Comment type=protein; loc=scaffold_6680:complement(3764182..3764760); ID=FBpp0161675; name=DmojGI12458-PA; parent=FBgn0135215,FBtr0163183; dbxref=FlyBase:FBpp0161675,FlyBase_Annotation_IDs:GI12458-PA,GB_protein:EDW17772,REFSEQ:XP_002007296,FlyMine:FBpp0161675; MD5=5d77e935edff35e1270a2dfe42e16ce8; length=192; release=r1.3; species=Dmoj;
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCNNVPIILVGTKLDLR
DDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPP
IRNTRKRKCLIL
Download sequence
Identical sequences B4KYQ8
XP_002007296.1.58863 XP_017864017.1.65068 FBpp0161675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]