SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162758 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162758
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000491
Family PAPS sulfotransferase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162758   Gene: FBgn0136296   Transcript: FBtr0164266
Sequence length 284
Comment type=protein; loc=scaffold_6680:join(14534072..14534583,14535216..14535370,14535432..14535619); ID=FBpp0162758; name=DmojGI13541-PA; parent=FBgn0136296,FBtr0164266; dbxref=FlyBase:FBpp0162758,FlyBase_Annotation_IDs:GI13541-PA,GB_protein:EDW18982,REFSEQ:XP_002008506,FlyMine:FBpp0162758; MD5=b08b4e93d3209e15623f80ce041b7fb1; length=284; release=r1.3; species=Dmoj;
Sequence
MDRIFFTRCAKVGSESLLEFMEDLQDVNNFEVDYLGLKRSGPRILTPKQQSKRARHIFNQ
APGTVYIEHTSWIDFHHYNLPKPIFINLVRDPVERMISWYYYVRNSYLNAIFYRKHPTAT
IKPVDWYKKSFNDCVRNGDAECQYVPETVKDYVGNYKRQSLFFCGHDRDCLPFDSPLAIQ
IAKRRVEEEYAVVGTWEETNITLTVLEHYIPRYFARATKLYPLYQKSLQNRNRNNRKPKV
DADVKAMVRRNFTHEYDFYYFCKQRLFKQYIALKRAELERLNFD
Download sequence
Identical sequences FBpp0162758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]