SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162881 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162881
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-61
Family G proteins 0.0000000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162881   Gene: FBgn0136419   Transcript: FBtr0164389
Sequence length 207
Comment type=protein; loc=scaffold_6680:join(17497481..17497604,17498640..17498700,17498761..17498965,17499032..17499172,17499235..17499327); ID=FBpp0162881; name=DmojGI13664-PA; parent=FBgn0136419,FBtr0164389; dbxref=FlyBase:FBpp0162881,FlyBase_Annotation_IDs:GI13664-PA,GB_protein:EDW19219,REFSEQ:XP_002008743,FlyMine:FBpp0162881; MD5=a0269da65cd2d7c4a2385a1e7a84a248; length=207; release=r1.3; species=Dmoj;
Sequence
MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENAAADVEKMLLG
NKCELNDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEAN
NPPKGGHQLKLTEIRTKDSWLSRCSLL
Download sequence
Identical sequences B4L0W9 B4LBM1
XP_002008743.1.58863 XP_002048489.1.90633 XP_017861689.1.65068 XP_017956712.1.46654 FBpp0162881 7244.FBpp0228416 FBpp0228416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]