SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0163250 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163250
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.91e-52
Family G proteins 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163250   Gene: FBgn0136787   Transcript: FBtr0164758
Sequence length 264
Comment type=protein; loc=scaffold_6500:complement(6425418..6425825,6425890..6426084,6428828..6429019); ID=FBpp0163250; name=DmojGI14033-PA; parent=FBgn0136787,FBtr0164758; dbxref=FlyBase:FBpp0163250,FlyBase_Annotation_IDs:GI14033-PA,GB_protein:EDW11585,REFSEQ:XP_002002143,FlyMine:FBpp0163250; MD5=300531c089f8c2e8b2cd89fddb45926e; length=264; release=r1.3; species=Dmoj;
Sequence
MTNMRPPQKSKLLKVVILGDGGVGKSALLTRFVSNRYEENNFHTIGVEFMNKDIAVDGEK
YTLQIWDTAGQERFRALRTPFYRGSDMCLLCYALDDRDSLRGLRLWRNEFINYADVQPDR
FPFIVVGNKNDIRAERRQVSYEDVQQWCAEHGISAHIETSSKTATNVTDAFVLALRQWKA
MERVAEAEQRQHGDTIDLTQPIRLMQRRQCCTGGGTGKAADVVDADDDDGRNTDAAMRSP
SSMSRHLFGQSRSSPKAPKTNYQL
Download sequence
Identical sequences B4KK67
XP_002002143.1.58863 FBpp0163250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]