SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0163328 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163328
Domain Number 1 Region: 19-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.1e-40
Family G proteins 0.0000575
Further Details:      
 
Weak hits

Sequence:  FBpp0163328
Domain Number - Region: 246-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000164
Family G proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163328   Gene: FBgn0136865   Transcript: FBtr0164836
Sequence length 293
Comment type=protein; loc=scaffold_6498:join(1470047..1470100,1470160..1470279,1470342..1470439,1470587..1470689,1470743..1471249); ID=FBpp0163328; name=DmojGI14111-PA; parent=FBgn0136865,FBtr0164836; dbxref=FlyBase:FBpp0163328,FlyBase_Annotation_IDs:GI14111-PA,GB_protein:EDW10939,REFSEQ:XP_002011449,FlyMine:FBpp0163328; MD5=f4f23fbef6f17b00605a0c722323f723; length=293; release=r1.3; species=Dmoj;
Sequence
MGATIVKNGNLLDALPTQGTLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQ
GTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVVDSVDTERMEEAKMELMRTAK
CPDNQGVPVLILANKQDLPSACCPKQLENLLGLHELHYPILNLSSTSTSTSTGNIAGFAT
SNQSYTDHGTTSLTDVNKDTDNSHVRSKDNFQLDSKSTSSHADSKCKGSSSPAALNNPQQ
QLTVKHPNLNVKGWYIQPACAITGEGLQEGLDALYDMILKRRKISKSHKKNKR
Download sequence
Identical sequences B4L7E5
XP_002011449.1.58863 FBpp0163328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]