SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0163681 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163681
Domain Number 1 Region: 2-114,151-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-24
Family G proteins 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163681   Gene: FBgn0137216   Transcript: FBtr0165189
Sequence length 272
Comment type=protein; loc=scaffold_6482:join(2155963..2156002,2156059..2156559,2156622..2156899); ID=FBpp0163681; name=DmojGI14464-PA; parent=FBgn0137216,FBtr0165189; dbxref=FlyBase:FBpp0163681,FlyBase_Annotation_IDs:GI14464-PA,GB_protein:EDW08047,REFSEQ:XP_002011926,FlyMine:FBpp0163681; MD5=ba5dfd19fe4d9643bb9ae2dff88d4929; length=272; release=r1.3; species=Dmoj;
Sequence
MNKRVRIVVVGDSGVGKTCLTHLVAHNESLIRPGWTVGCNIQVKIHEFKEGTARQCPYFI
ELFDIGGSLSHKNTRSVFYSGIHGIILVHDLTNGKSQEQLLDWLFEIVNKDGKDTYKCRS
PSSPPSPTPLHGYGTDTSMRFDLEEFLGATQIPILVMGTKLDLIDEKRQPKTAVKKVGGI
ADKCGAEEIWLNCRDTRSLAAGTTDAVKLSRFFDCVIEKRESNGCPGAHLVASTATDRRR
VANSLPSSPEFPIYASKATETFVPLLETNDLK
Download sequence
Identical sequences FBpp0163681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]