SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0164749 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0164749
Domain Number 1 Region: 14-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-47
Family G proteins 0.0000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164749   Gene: FBgn0138281   Transcript: FBtr0166257
Sequence length 200
Comment type=protein; loc=scaffold_6473:join(5421338..5421430,5421490..5421742,5421802..5422058); ID=FBpp0164749; name=DmojGI15532-PA; parent=FBgn0138281,FBtr0166257; dbxref=FlyBase:FBpp0164749,FlyBase_Annotation_IDs:GI15532-PA,GB_protein:EDW07077,REFSEQ:XP_002009760,FlyMine:FBpp0164749; MD5=a27175c8ee14c0249f6d4dddf7fa50ed; length=200; release=r1.3; species=Dmoj;
Sequence
MYTLLHGFYKYLTQKDEYCVVILGLDNAGKTTYLEAAKTKFTKNYKGLNPAKITTTVGLN
IGTIDVHGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMDESKVIFDKMIK
NELLSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTIPVSALTGEGVDEGI
KWLVEAIKRHSLVRPPREND
Download sequence
Identical sequences B4L3E9
FBpp0164749 XP_002009760.1.58863 XP_017870814.1.65068 XP_017963485.1.46654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]