SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165422 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165422
Domain Number 1 Region: 7-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-55
Family G proteins 0.00000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165422   Gene: FBgn0138954   Transcript: FBtr0166930
Sequence length 218
Comment type=protein; loc=scaffold_6328:complement(1235377..1235925,1236254..1236361); ID=FBpp0165422; name=DmojGI16205-PA; parent=FBgn0138954,FBtr0166930; dbxref=FlyBase:FBpp0165422,FlyBase_Annotation_IDs:GI16205-PA,GB_protein:EDW05915,REFSEQ:XP_002011073,FlyMine:FBpp0165422; MD5=20eb355adef5f0c4f2dd6ad827461408; length=218; release=r1.3; species=Dmoj;
Sequence
MVEPIFDYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIK
LQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFA
LVGCKLDLVNAGGHREVTTEEAQTFAKQHGLHFVETSARTGANVEEAFRMVTQEVYARIR
SGEYKAEDGWDGIKSGFARPNSLDFNLVVAEPEKSSCC
Download sequence
Identical sequences B4L6B9
XP_002011073.1.58863 XP_017870643.1.65068 XP_017965122.1.46654 FBpp0165422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]