SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165515 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165515
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-46
Family G proteins 0.0000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165515   Gene: FBgn0139046   Transcript: FBtr0167023
Sequence length 195
Comment type=protein; loc=scaffold_6328:join(512508..512560,512759..513191,513263..513364); ID=FBpp0165515; name=DmojGI16298-PA; parent=FBgn0139046,FBtr0167023; dbxref=FlyBase:FBpp0165515,FlyBase_Annotation_IDs:GI16298-PA,GB_protein:EDW05838,REFSEQ:XP_002010996,FlyMine:FBpp0165515; MD5=6b5b84451e9b7006f602359cf13df0f2; length=195; release=r1.3; species=Dmoj;
Sequence
MADRAIKLLIIGESGVGNLIRRFVENKFDDNHDVTIGMDFKSAIMNVDGIDYKVALWDTA
GAERFRSLTPSFYRKALGAILVYDITNRESLVKLDAWMAELDSYSDNPNIAIIVVGNKID
KDRVVDREDGRKFARKHRALFIETSAKCDQFVSDVFKDIVEKIVSSEYFVNGNTSNGMTI
DNTQDVDSSPSTCYC
Download sequence
Identical sequences FBpp0165515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]