SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165712 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165712
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000221
Family RecA protein-like (ATPase-domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165712   Gene: FBgn0139243   Transcript: FBtr0167220
Sequence length 181
Comment type=protein; loc=scaffold_6328:join(4253537..4253606,4253671..4253837,4253898..4254026,4254085..4254264); ID=FBpp0165712; name=DmojGI16495-PA; parent=FBgn0139243,FBtr0167220; dbxref=FlyBase:FBpp0165712,FlyBase_Annotation_IDs:GI16495-PA,GB_protein:EDW06213,REFSEQ:XP_002011371,FlyMine:FBpp0165712; MD5=a0f2bc02a8da119e37cffa09391fbd60; length=181; release=r1.3; species=Dmoj;
Sequence
EYGSEAKAIYFDTRKDFDPIRLKELAEELVTRPSVRQTSGLLPTATEMLRNVFYVDCHTA
AHLVAGLLNCYKYLAREPNIKLIIVDSISFAIRSLDNILARTELLMELHTVMRKLQMKHN
LTFVLTNNLAFRRKRRRRFELEAVLGQKHAQIINKRIWLMKNGCFLGKWSKTKRFICKLS
T
Download sequence
Identical sequences FBpp0165712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]