SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165789 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165789
Domain Number 1 Region: 5-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.25e-52
Family G proteins 0.000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165789   Gene: FBgn0139320   Transcript: FBtr0167297
Sequence length 192
Comment type=protein; loc=scaffold_6654:complement(1841737..1842146,1842217..1842304,1843455..1843535); ID=FBpp0165789; name=DmojGI16572-PA; parent=FBgn0139320,FBtr0167297; dbxref=FlyBase:FBpp0165789,FlyBase_Annotation_IDs:GI16572-PA,GB_protein:EDW17313,REFSEQ:XP_002012182,FlyMine:FBpp0165789; MD5=8d04fa5c81739b3e229ca6a3c3ddd6cf; length=192; release=r1.3; species=Dmoj;
Sequence
MQMQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCVIDDVPAKLDILDT
AGQEEFSAMREQYMRSGEGFLLVFSLNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKC
DLEHQRHVSLEEAQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPYIEEG
FKKKGKKKCCLM
Download sequence
Identical sequences B4L9D8
XP_002012182.1.58863 XP_017966220.1.46654 FBpp0165789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]