SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165839 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165839
Domain Number 1 Region: 13-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.12e-52
Family G proteins 0.000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165839   Gene: FBgn0139370   Transcript: FBtr0167347
Sequence length 179
Comment type=protein; loc=scaffold_6654:complement(1388458..1388997); ID=FBpp0165839; name=DmojGI16622-PA; parent=FBgn0139370,FBtr0167347; dbxref=FlyBase:FBpp0165839,FlyBase_Annotation_IDs:GI16622-PA,GB_protein:EDW17225,REFSEQ:XP_002012094,FlyMine:FBpp0165839; MD5=a614c727bfbdc018dda8431fb59e8db6; length=179; release=r1.3; species=Dmoj;
Sequence
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEVVWRNI
HFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLSKASL
LVYANKQDLKGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWVAQRIKNK
Download sequence
Identical sequences B4L950
XP_002012094.1.58863 XP_017863615.1.65068 XP_017957503.1.46654 XP_017957504.1.46654 FBpp0165839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]