SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165997 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165997
Domain Number 1 Region: 18-207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.62e-59
Family G proteins 0.00000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165997   Gene: FBgn0139527   Transcript: FBtr0167505
Sequence length 219
Comment type=protein; loc=scaffold_6654:join(1386526..1386738,1386816..1386900,1387307..1387563,1387622..1387726); ID=FBpp0165997; name=DmojGI16780-PA; parent=FBgn0139527,FBtr0167505; dbxref=FlyBase:FBpp0165997,FlyBase_Annotation_IDs:GI16780-PA,GB_protein:EDW17224,REFSEQ:XP_002012093,FlyMine:FBpp0165997; MD5=63eb5fad5c98f96d2a3be9a25146038d; length=219; release=r1.3; species=Dmoj;
Sequence
MTARNPQTLMALPNEENFDFLFKIVLIGDCCTGKTSILQRFKTGNYVERHGNTIGVDFSM
KTIEVEGKQVKLQIWDTAGQERFRTITQSYYRANNGVIIVYDITKRATFANLQKWIEEVR
RYTASNVLIILIGNKCDLESEREVDFEEARQMCQYIPEILFVMETSAKENTNVEDAFRCL
ATELKRQHDSSNVQALDENTVQLGQSKPLKSCSSSCNLT
Download sequence
Identical sequences B4L949
XP_002012093.1.58863 XP_017863613.1.65068 FBpp0165997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]