SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0166436 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0166436
Domain Number 1 Region: 79-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-16
Family PAPS sulfotransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0166436   Gene: FBgn0139963   Transcript: FBtr0167944
Sequence length 291
Comment type=protein; loc=scaffold_6500:join(6414976..6415090,6415152..6415408,6415474..6415559,6415613..6415751,6415821..6416041,6416107..6416164); ID=FBpp0166436; name=DmojGI17219-PA; parent=FBgn0139963,FBtr0167944; dbxref=FlyBase:FBpp0166436,FlyBase_Annotation_IDs:GI17219-PA,GB_protein:EDW11583,REFSEQ:XP_002002141,FlyMine:FBpp0166436; MD5=a5bd50193709e2bf1c5f99129082e221; length=291; release=r1.3; species=Dmoj;
Sequence
MYKKFRKILPAMRPVHWLVLSCIAVVTCYFLLEIRLDRAFKPLSKLTVNSGKQSVADQAA
LSRSIPTFDGFDYEEQLVVLYNRVPKTGSTSFVNIAYDLCKQNRYHVLHINVTANMHVLS
LPNQISFVRNVTKWHVMKPALYHGHMAFLDFSKFQIAHKPIYINLVRKPLDRLVSYYYFL
RYGDNYRPNLVRKKAGNKITFDECVVQKQPDCDPKNMWLQIPFFCGHAAECWEPGSDWAL
KQAKHNLVNEYFLVGVTEQMYEFVDLLERSLPRIFQGFREHYQTQINLTYG
Download sequence
Identical sequences FBpp0166436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]