SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167516 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167516
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.03e-25
Family G proteins 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167516   Gene: FBgn0141038   Transcript: FBtr0169024
Sequence length 122
Comment type=protein; loc=scaffold_5947:complement(4826..4930,4989..5252); ID=FBpp0167516; name=DmojGI18299-PA; parent=FBgn0141038,FBtr0169024; dbxref=FlyBase:FBpp0167516,FlyBase_Annotation_IDs:GI18299-PA,GB_protein:EDW05452,REFSEQ:XP_002012570,FlyMine:FBpp0167516; MD5=b8864d37bb924493ceee0c15070a5601; length=122; release=r1.3; species=Dmoj;
Sequence
MTVYDITKRATFANLQKWIEEVRRYTASNVLIILIGNKCDLESEREVDFEEARQMCQYIP
EILFVMETSAKENTNVEDAFRCLATELKRQHDSSNVQALDENTVQLGQSKPLKSCSSSCN
LT
Download sequence
Identical sequences B4LAL6
XP_002012570.1.58863 FBpp0167516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]