SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167581 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167581
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.46e-59
Family G proteins 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167581   Gene: FBgn0141103   Transcript: FBtr0169089
Sequence length 213
Comment type=protein; loc=scaffold_6496:complement(25515864..25516075,25516133..25516465,25516805..25516885,25516946..25516961); ID=FBpp0167581; name=DmojGI18364-PA; parent=FBgn0141103,FBtr0169089; dbxref=FlyBase:FBpp0167581,FlyBase_Annotation_IDs:GI18364-PA,GB_protein:EDW10790,REFSEQ:XP_002006855,FlyMine:FBpp0167581; MD5=8f94c5744ee4384fb520a0f6a281c4f7; length=213; release=r1.3; species=Dmoj;
Sequence
MSETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQ
IWDTAGQERFRSVTRSYYRGAAGALLVYDSTSRDSFNALTNWLNDARTLASPNIVILLVG
NKKDLEEARDVTFLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKIETGELDP
ERIGSGIQYGGAALRNLQTRQRSINKPDCTCRV
Download sequence
Identical sequences B4KM01
XP_002006855.1.58863 XP_017094107.1.53830 XP_017867705.1.65068 XP_017960456.1.46654 FBpp0167581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]