SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167934 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167934
Domain Number 1 Region: 166-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000077
Family Motor proteins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167934   Gene: FBgn0141456   Transcript: FBtr0169442
Sequence length 242
Comment type=protein; loc=scaffold_6496:complement(17065990..17066216,17079583..17079777,17120557..17120863); ID=FBpp0167934; name=DmojGI18717-PA; parent=FBgn0141456,FBtr0169442; dbxref=FlyBase:FBpp0167934,FlyBase_Annotation_IDs:GI18717-PA,GB_protein:EDW10087,REFSEQ:XP_002006152,FlyMine:FBpp0167934; MD5=6f90ab40f0e6123e1e4dc7cf2faa94b1; length=242; release=r1.3; species=Dmoj;
Sequence
MGCNTSQELKTKDGGAIDAVSNGEPEPSAPQMELDDGGNSCSVKSSNNHTNHAKSNSIIS
NGDAKAAAVAAITKGASAATNGVDRSCDKAEITEFNDDVEEEAKAATKIQAVFRGHKVRE
TMKKSETKTTTNNGSASASAPAPASAAAAEPEPTKAELEAEFDPNDKELCHAALKIQSTF
RGHLARKLVNKDVPEDEDIQEITKKVAEELDIDLTDPELNKAATKIQASFRGHKIRRETN
PE
Download sequence
Identical sequences B4KP21
XP_002006152.1.58863 FBpp0167934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]