SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168068 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168068
Domain Number 1 Region: 40-67,185-380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-62
Family G proteins 0.0000000196
Further Details:      
 
Domain Number 2 Region: 74-189
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.24e-35
Family Transducin (alpha subunit), insertion domain 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168068   Gene: FBgn0141590   Transcript: FBtr0169576
Sequence length 382
Comment type=protein; loc=scaffold_6496:complement(14906523..14906669,14906735..14906808,14907101..14907225,14907285..14907464,14907537..14907665,14908360..14908480,14908638..14908734,14910361..14910636); ID=FBpp0168068; name=DmojGI18851-PA; parent=FBgn0141590,FBtr0169576; dbxref=FlyBase:FBpp0168068,FlyBase_Annotation_IDs:GI18851-PA,GB_protein:EDW09806,REFSEQ:XP_002005871,FlyMine:FBpp0168068; MD5=0db826d9a71f25868c5e5a351208025a; length=382; release=r1.3; species=Dmoj;
Sequence
MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIV
KQMRILHVDGFSEQEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQ
DYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTP
NEQDILRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSS
YNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYF
SEFNKYQTPSDAIMESNDDPEVIRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENI
KRVFNDCRDIIQRMHLRQYELL
Download sequence
Identical sequences B4KMB8 B4LNZ7
7244.FBpp0236303 XP_002005871.1.58863 XP_002049973.1.90633 XP_015019511.1.58863 XP_015029881.1.90633 XP_017867779.1.65068 XP_017867780.1.65068 FBpp0168068 FBpp0236303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]