SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168233 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168233
Domain Number 1 Region: 3-161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.75e-49
Family G proteins 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168233   Gene: FBgn0141755   Transcript: FBtr0169741
Sequence length 259
Comment type=protein; loc=scaffold_6496:complement(12378941..12379549,12380618..12380745,12382438..12382480); ID=FBpp0168233; name=DmojGI19016-PA; parent=FBgn0141755,FBtr0169741; dbxref=FlyBase:FBpp0168233,FlyBase_Annotation_IDs:GI19016-PA,GB_protein:EDW09471,REFSEQ:XP_002005536,FlyMine:FBpp0168233; MD5=4f11865dc59c3105bf3fcfe7988dbca7; length=259; release=r1.3; species=Dmoj;
Sequence
MRGIEGKVVVLGSRGVGKSRLVIKYIKNALHRSEEPTIAVSFFTCNIMLDDVKIKLQIWD
TAGQERFRAVAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKM
DLQSQRAVSRDEAYLFASSIGATYFETSTETDQGLEQVFLSTALGLVRLADEGKSHSLRS
FESTDSLFYTNGNTAFSYTAAAVVRNEDGAAFRLPYVHIGIPVDGQDVKATGEGRLETPS
WAIEHIALGEVERVRWCCY
Download sequence
Identical sequences B4KSG6
XP_002005536.1.58863 FBpp0168233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]