SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168307 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168307
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-52
Family G proteins 0.000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168307   Gene: FBgn0141829   Transcript: FBtr0169815
Sequence length 200
Comment type=protein; loc=scaffold_6496:complement(11226842..11227051,11227109..11227345,11227703..11227858); ID=FBpp0168307; name=DmojGI19090-PA; parent=FBgn0141829,FBtr0169815; dbxref=FlyBase:FBpp0168307,FlyBase_Annotation_IDs:GI19090-PA,GB_protein:EDW09337,REFSEQ:XP_002005402,FlyMine:FBpp0168307; MD5=4053716ce97228ae80b6a45824da3044; length=200; release=r1.3; species=Dmoj;
Sequence
MSSIRKKLVIVGDGACGKTCLLTVFCKDSFPLDYVPTVFETYVADVEVEGSQVELALWDT
AGQEDYDRLRLLSYPDTDVIVMCFSIDLPDSLENIQDKWIPEVKHFCPNVPIILVGNKRD
LRHDPDTIRASELSLQKQQPVQTEQGFTMAEIVNAFAYLECSAKMQEGVREVFETATRAS
LQVKKRKKRSGCWSLSCKLL
Download sequence
Identical sequences FBpp0168307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]