SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168515 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168515
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.4e-59
Family G proteins 0.0000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168515   Gene: FBgn0142037   Transcript: FBtr0170023
Sequence length 213
Comment type=protein; loc=scaffold_6496:complement(8325366..8325464,8325529..8325865,8325938..8326097,8327499..8327544); ID=FBpp0168515; name=DmojGI19298-PA; parent=FBgn0142037,FBtr0170023; dbxref=FlyBase:FBpp0168515,FlyBase_Annotation_IDs:GI19298-PA,GB_protein:EDW08942,REFSEQ:XP_002005007,FlyMine:FBpp0168515; MD5=cafa9efafe702ef91b9635dde71ebecc; length=213; release=r1.3; species=Dmoj;
Sequence
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGQQATPTNPALPGAGGAGGAVNSGCC
Download sequence
Identical sequences B4KNI3
XP_002005007.1.58863 XP_017866806.1.65068 XP_017960952.1.46654 FBpp0168515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]