SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169390 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169390
Domain Number 1 Region: 17-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.06e-61
Family G proteins 0.0000000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169390   Gene: FBgn0142909   Transcript: FBtr0170898
Sequence length 220
Comment type=protein; loc=scaffold_6496:join(7136307..7136531,7138035..7138153,7138226..7138397,7138474..7138620); ID=FBpp0169390; name=DmojGI20173-PA; parent=FBgn0142909,FBtr0170898; dbxref=FlyBase:FBpp0169390,FlyBase_Annotation_IDs:GI20173-PA,GB_protein:EDW08839,REFSEQ:XP_002004904,FlyMine:FBpp0169390; MD5=0c658179c6f1e123878c15b4a399466b; length=220; release=r1.3; species=Dmoj;
Sequence
MAGGGDPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKV
KTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIK
TYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVD
IICDKMSESLDADPTLVGGNQKGQRLTDQPQGTPNANCNC
Download sequence
Identical sequences B4KN12
XP_002004904.1.58863 XP_017867948.1.65068 XP_017867949.1.65068 XP_017961239.1.46654 XP_017961240.1.46654 FBpp0169390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]