SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169647 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169647
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-21
Family Nucleotide and nucleoside kinases 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169647   Gene: FBgn0143166   Transcript: FBtr0171155
Sequence length 172
Comment type=protein; loc=scaffold_6496:join(10897514..10897550,10897607..10897758,10897814..10898143); ID=FBpp0169647; name=DmojGI20430-PA; parent=FBgn0143166,FBtr0171155; dbxref=FlyBase:FBpp0169647,FlyBase_Annotation_IDs:GI20430-PA,GB_protein:EDW09286,REFSEQ:XP_002005351,FlyMine:FBpp0169647; MD5=47f26448570f92092cbcf842c236d7e0; length=172; release=r1.3; species=Dmoj;
Sequence
MTEIGKPNILITGTPGAGKSYLCQRLAEQLKFTWLDCSKIAKEKNFIEEYDEEYDCPILD
EDKLMDYLEPLMTKGGNIVEYHGCDFFPERWFHAVFVVTCPNKTLYDRLKERNYNEKKLT
SNIQCEIFGTILEEARESYKSGIVYELKGETKADGERSLKTVRNWYSMWKRK
Download sequence
Identical sequences FBpp0169647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]