SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169693 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169693
Domain Number 1 Region: 32-61,178-347
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.15e-59
Family G proteins 0.0000000246
Further Details:      
 
Domain Number 2 Region: 61-180
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.14e-41
Family Transducin (alpha subunit), insertion domain 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169693   Gene: FBgn0143212   Transcript: FBtr0171201
Sequence length 353
Comment type=protein; loc=scaffold_6496:join(11737132..11737249,11737736..11737920,11737980..11738134,11738280..11738408,11739109..11739238,11739306..11739459,11739579..11739686,11740298..11740380); ID=FBpp0169693; name=DmojGI20476-PA; parent=FBgn0143212,FBtr0171201; dbxref=FlyBase:FBpp0169693,FlyBase_Annotation_IDs:GI20476-PA,GB_protein:EDW09380,REFSEQ:XP_002005445,FlyMine:FBpp0169693; MD5=c0f96814ec1eebc6833f44474bb6579b; length=353; release=r1.3; species=Dmoj;
Sequence
MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGVGEHNALADLVMSIDYETVTTFED
PYLNAIKTLWSDAGIQECYDRRREYQLTDSAKYYLMDLDRVAQPDYLPTEQDILRVRVPT
TGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN
RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAIAAR
EFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYNLV
Download sequence
Identical sequences B4KRT9
XP_002005445.1.58863 XP_015019246.1.58863 XP_017865763.1.65068 XP_017959720.1.46654 FBpp0169693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]