SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169915 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169915
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-50
Family G proteins 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169915   Gene: FBgn0143433   Transcript: FBtr0171423
Sequence length 182
Comment type=protein; loc=scaffold_6496:join(14836104..14836238,14838151..14838288,14838396..14838513,14838695..14838852); ID=FBpp0169915; name=DmojGI20698-PA; parent=FBgn0143433,FBtr0171423; dbxref=FlyBase:FBpp0169915,FlyBase_Annotation_IDs:GI20698-PA,GB_protein:EDW09786,REFSEQ:XP_002005851,FlyMine:FBpp0169915; MD5=5df8605e7c31dcf1af120ccb20c2fcd5; length=182; release=r1.3; species=Dmoj;
Sequence
MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAG
TEQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDL
DCQREVSTAEGNALAHLWECPFIEASAKDRINVNEVFATIVREMNLTQEKRQKKKYCCCT
LL
Download sequence
Identical sequences B4KLX6
FBpp0169915 XP_002005851.1.58863 XP_017866540.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]