SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169948 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169948
Domain Number 1 Region: 14-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-39
Family G proteins 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169948   Gene: FBgn0143466   Transcript: FBtr0171456
Sequence length 202
Comment type=protein; loc=scaffold_6496:join(15041875..15042052,15042105..15042233,15042293..15042421,15042489..15042661); ID=FBpp0169948; name=DmojGI20731-PA; parent=FBgn0143466,FBtr0171456; dbxref=FlyBase:FBpp0169948,FlyBase_Annotation_IDs:GI20731-PA,GB_protein:EDW09835,REFSEQ:XP_002005900,FlyMine:FBpp0169948; MD5=bd84218edecf74a67ccd9c58bffb8a93; length=202; release=r1.3; species=Dmoj;
Sequence
MGMLHNLTGLIKVKKDKMTILVLGLNNSGKSTIINHFKKSNEQSAIMVPTVGFLIEQFYN
MGVCIKAIDMSGATRYRNLWEHQFKNCQGIIYVIDSSDRMRFVVVKDELDLVLQHPDLRN
RILPILFYGNKSDLEDSLSNVKIAAALGLENIKDKPWHICSSNAISGEGLDEGIQWLVQQ
IRFALLSNRKGSKMKMVSKDIK
Download sequence
Identical sequences B4KME7
FBpp0169948 XP_002005900.1.58863 XP_017865040.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]