SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170832 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170832
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.54e-40
Family G proteins 0.0000267
Further Details:      
 
Domain Number 2 Region: 191-230
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000144
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170832   Gene: FBgn0144345   Transcript: FBtr0172340
Sequence length 262
Comment type=protein; loc=scaffold_6359:complement(577986..578203,578272..578494,578553..578776,578839..578962); ID=FBpp0170832; name=DmojGI21615-PA; parent=FBgn0144345,FBtr0172340; dbxref=FlyBase:FBpp0170832,FlyBase_Annotation_IDs:GI21615-PA,GB_protein:EDW06270,REFSEQ:XP_002010615,FlyMine:FBpp0170832; MD5=f868d3e37fe9d973c56dbd62195e33c3; length=262; release=r1.3; species=Dmoj;
Sequence
MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVAYKTTTILL
EGKRVKLQIWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVEEHAPG
IPKVLVGNRLHLAYKRQVAAKTAETYASRNNMSCFEISPLCDFNIRESFCELARMALHRN
GMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLHLPPSVKSTLKSYAMTTSQCYNSLTQ
NSKSRNRCKTPTSHSRNSCAIA
Download sequence
Identical sequences FBpp0170832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]