SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171232 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171232
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.08e-57
Family G proteins 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171232   Gene: FBgn0144744   Transcript: FBtr0172740
Sequence length 195
Comment type=protein; loc=scaffold_6540:complement(32465582..32465659,32465733..32465893,32465959..32466191,32466255..32466370); ID=FBpp0171232; name=DmojGI22015-PA; parent=FBgn0144744,FBtr0172740; dbxref=FlyBase:FBpp0171232,FlyBase_Annotation_IDs:GI22015-PA,GB_protein:EDW16825,REFSEQ:XP_002001364; MD5=82476323d7305d6c23532ec0bb8337f7; length=195; release=r1.3; species=Dmoj;
Sequence
MSTGRPIKCVVVGDGTVGKTCMLISYTTDSFPGEYVPTVFDNYSAPMQVDTIQVSLGLWD
TAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKI
DLRDDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKQVFEEAVRAVL
RPEPLKRRQRKCLVM
Download sequence
Identical sequences A0A0M3QXJ2 B4JRY0 B4KB97
7222.FBpp0153180 XP_001993784.1.65300 XP_002001364.1.58863 XP_017847116.1.30616 XP_017863450.1.65068 XP_017957106.1.46654 FBpp0171232 FBpp0153180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]