SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171337 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171337
Domain Number 1 Region: 88-272
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000522
Family Nucleotide and nucleoside kinases 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171337   Gene: FBgn0144849   Transcript: FBtr0172845
Sequence length 289
Comment type=protein; loc=scaffold_6540:complement(30376347..30377216); ID=FBpp0171337; name=DmojGI22120-PA; parent=FBgn0144849,FBtr0172845; dbxref=FlyBase:FBpp0171337,FlyBase_Annotation_IDs:GI22120-PA,GB_protein:EDW16627,REFSEQ:XP_002001166,FlyMine:FBpp0171337; MD5=8f0c0e800a020084ae6cf2a3552ffbce; length=289; release=r1.3; species=Dmoj;
Sequence
MATAIRMDRDALVRFSASYMYYVEKHKLLDIMSRILAEATVQQIEDVRRWLGENIRHIAQ
EIYSKAMNAFHLGIDADYYQLPKNFYHRIVLHGRVGSGRRSLAHVLAQRWNLLILDADTL
AYHHINGQARGRKVPLLHEGIEKRSVYKISEAIGNIIQKRLLQEDALHRGWILINYPNNR
CEARELFESFSVPPNRLIFLQVDEQTARMRLLMRKYAPCPQDNITYMDYQMQQFRKSEPL
LNTYLSHRREVLYVDATECFETVKCFIMSQLTKTPYMLGYKYGESSPID
Download sequence
Identical sequences B4K9G7
XP_002001166.1.58863 FBpp0171337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]