SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171818 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171818
Domain Number 1 Region: 7-171
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-54
Family G proteins 0.0000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171818   Gene: FBgn0145329   Transcript: FBtr0173326
Sequence length 185
Comment type=protein; loc=scaffold_6540:complement(22143710..22144033,22144114..22144347); ID=FBpp0171818; name=DmojGI22601-PA; parent=FBgn0145329,FBtr0173326; dbxref=FlyBase:FBpp0171818,FlyBase_Annotation_IDs:GI22601-PA,GB_protein:EDW15759,REFSEQ:XP_002000298,FlyMine:FBpp0171818; MD5=08fce74b36e27b42d03074c3242bcf91; length=185; release=r1.3; species=Dmoj;
Sequence
MSKSLRPLKITIVGDGMVGKTCLLITYTQNEFPEEYIPTVFDNHACNITVDDNEYNLTLW
DTAGQEDYERLRPLSYPNTNCFLLCYSISSRTSFENIKSKWWPEIRHFGTNVPVVLVGTK
LDLRIPNSEKFVTTQEGRRLRKEIHAHSLVECSAKKKLNLEQVFEEAVRAVEKKPGKTPP
TCKIL
Download sequence
Identical sequences B4KB55
XP_002000298.1.58863 XP_017873514.1.65068 XP_017968609.1.46654 XP_017968610.1.46654 FBpp0171818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]