SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171850 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171850
Domain Number 1 Region: 6-126,161-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.2e-33
Family Nucleotide and nucleoside kinases 0.0000363
Further Details:      
 
Domain Number 2 Region: 126-162
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000000478
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171850   Gene: FBgn0145361   Transcript: FBtr0173358
Sequence length 217
Comment type=protein; loc=scaffold_6540:complement(21217846..21218499); ID=FBpp0171850; name=DmojGI22633-PA; parent=FBgn0145361,FBtr0173358; dbxref=FlyBase:FBpp0171850,FlyBase_Annotation_IDs:GI22633-PA,GB_protein:EDW15697,REFSEQ:XP_002000236,FlyMine:FBpp0171850; MD5=f164263914d0cb12c18414223dae4512; length=217; release=r1.3; species=Dmoj;
Sequence
MYTKIFRAVIIGAPGSGKGTISDRIVKTFGFLHISSGDILRQNIIKNTDLGKKAQQYIAS
GQLVPDDIMTKTMIARITEVGNKSYILDGFPRNSAQADILAAREQIDAVINLDIPHDVII
ERVKHRWIHAPSGRVYNIGFNDPKVAGKDDITGEPLTQREDDKPEVVSKRLQLYDELMGP
VLAWYAERGLVTSFKGRETKEIWPRVERFLKDKVNMG
Download sequence
Identical sequences B4KAI4
XP_002000236.1.58863 XP_015022791.1.58863 FBpp0171850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]