SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171960 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171960
Domain Number 1 Region: 18-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.82e-47
Family G proteins 0.0000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171960   Gene: FBgn0145470   Transcript: FBtr0173468
Sequence length 237
Comment type=protein; loc=scaffold_6540:complement(19544823..19545179,19545241..19545426,19545485..19545655); ID=FBpp0171960; name=DmojGI22743-PA; parent=FBgn0145470,FBtr0173468; dbxref=FlyBase:FBpp0171960,FlyBase_Annotation_IDs:GI22743-PA,GB_protein:EDW15519,REFSEQ:XP_002000058,FlyMine:FBpp0171960; MD5=06e23470054949204e17d59d6b7e3c9f; length=237; release=r1.3; species=Dmoj;
Sequence
MTEQKNQVTRAAPEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVIS
CNKNICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWELIKELKG
DVNSIPVMLVGNKCDESTELREVSQMEGQAQATTWGISFMETSAKTNHNVTELFQELLNM
EKTRTVSLQLDTKKQKKQKKEKKCKETNGAIPENGEASASASAGASGAGVKDKCGVM
Download sequence
Identical sequences B4K987
FBpp0171960 XP_002000058.1.58863 XP_015022705.1.58863 XP_015022706.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]