SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172122 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172122
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5e-37
Family Nucleotide and nucleoside kinases 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172122   Gene: FBgn0145632   Transcript: FBtr0173630
Sequence length 197
Comment type=protein; loc=scaffold_6540:complement(15836813..15837406); ID=FBpp0172122; name=DmojGI22905-PA; parent=FBgn0145632,FBtr0173630; dbxref=FlyBase:FBpp0172122,FlyBase_Annotation_IDs:GI22905-PA,GB_protein:EDW15210,REFSEQ:XP_001999749,FlyMine:FBpp0172122; MD5=2067d45eb2354d68ebc5de8771f391df; length=197; release=r1.3; species=Dmoj;
Sequence
MSSAKPKVVFVLGGPGAGKGTQCSKIVERFQFEHLSAGDLLREERSREGSEYGQLIEEYI
RNGKIVPVEVTCSLLENAMKNSGKSRFLIDGFPRNQDNLDGWNRQMSDKTEMQFVLFFDC
AEDVCVKRCLGRGQSGSGRSDDNMESLKKRIQTYNNDSLPIIKYFENAGQVKRIDASPDA
DKVFQEVERVFLANGFQ
Download sequence
Identical sequences FBpp0172122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]