SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0172611 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172611
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 3.92e-58
Family CutC-like 0.0000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172611   Gene: FBgn0146120   Transcript: FBtr0174119
Sequence length 260
Comment type=protein; loc=scaffold_6540:complement(7724590..7725372); ID=FBpp0172611; name=DmojGI23394-PA; parent=FBgn0146120,FBtr0174119; dbxref=FlyBase:FBpp0172611,FlyBase_Annotation_IDs:GI23394-PA,GB_protein:EDW14329,REFSEQ:XP_001998868,FlyMine:FBpp0172611; MD5=40780de1ab62775f8a63c8aaf47c4e88; length=260; release=r1.3; species=Dmoj;
Sequence
MSAHDIKLEVCVDSIKSAFAAEEGGAARIELCAALQEGGLTPTIGTLKTLKELPFTLPIH
CMLRPRRGTDFVYSEEELRAVLTDMELLRSHGADGFVFGALTPERTIDVDKCRRVMEQSY
GLPVTFHRAFDLTDNKYMHENVELLKELGFKRVLSSGFRASAAEGVEALAQLIAKHHRDM
IIMPGAGIKVSNLEEILTFSRCLEFHASALDTASEDYSAPTTTRMECDVTMGKQDIDPYY
GTNAYVVRKMVVIANAMSCR
Download sequence
Identical sequences B4K7Z5
FBpp0172611 XP_001998868.1.58863 XP_017858158.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]