SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172719 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172719
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000139
Family Tandem AAA-ATPase domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172719   Gene: FBgn0146228   Transcript: FBtr0174227
Sequence length 120
Comment type=protein; loc=scaffold_6540:complement(6133541..6133903); ID=FBpp0172719; name=DmojGI23502-PA; parent=FBgn0146228,FBtr0174227; dbxref=FlyBase:FBpp0172719,FlyBase_Annotation_IDs:GI23502-PA,GB_protein:EDW14135,REFSEQ:XP_001998674,FlyMine:FBpp0172719; MD5=8d5fe2826d0bcbe089321a2393234b95; length=120; release=r1.3; species=Dmoj;
Sequence
MTLTSSNTQDTIKNFNESDEPCVLLLTLGLAKSGLNLYGANSLLVMDSHWNPHLKPQSAI
YRMDQRNRNVSVYQLVCKDTVDGTIQQVQQNKLNLAFQVLRASAISTIRRVIKYFQSLWL
Download sequence
Identical sequences FBpp0172719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]